PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00614.10
Common NameJCGZ_18291, LOC105641987
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 387aa    MW: 42545.7 Da    PI: 6.5167
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00614.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.23.9e-28223272756
        G2-like   7 tpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    +peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Jcr4S00614.10 223 SPELHRRFLHALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 272
                    79**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.035214274IPR017930Myb domain
SuperFamilySSF466891.79E-13219275IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-23223272IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.5E-24223275IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MDYTEKLQRC HEYVEALEEE RRKIQVFQRE LPLCLELVTQ AIEACKRELS GTTTEYMHGQ  60
SECSVQTSSD GIATRPPVLE EFIPIKRTHS SSDNDYEEEE EEDDDDDNEN SMIKNTIRII  120
KRNDKNIKDK DKNSSADHKK KSDWLRSVQL WNQSADPPLK EDLPRKIAVS EVKRNGVPAS  180
ATSSTEETKT GGTGNGSGNG GGGSGKKDEK ESSTKENNDG VRSPELHRRF LHALQQLGGS  240
HAATPKQIRE LMKVDGLTND EVKSHLQKYR LHTRRPSPTI HNNNNPQAPQ FVVVGGIWVP  300
PADYATVAAG TTTTSGETAT IAAANGLYAP VASRPPASSH LVQKLEHTQS EGRDSRSEGS  360
PVHSRGGRSN SPATSSSTHT TTNSPLF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082036.10.0PREDICTED: uncharacterized protein LOC105641987
TrEMBLA0A067KAT10.0A0A067KAT1_JATCU; Uncharacterized protein
STRINGPOPTR_0008s11630.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.16e-83G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]